Protein Info for Dsui_2307 in Dechlorosoma suillum PS

Annotation: putative ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00005: ABC_tran" amino acids 20 to 166 (147 residues), 130.9 bits, see alignment E=5e-42

Best Hits

Swiss-Prot: 57% identical to YBBA_ECOLI: Uncharacterized ABC transporter ATP-binding protein YbbA (ybbA) from Escherichia coli (strain K12)

KEGG orthology group: K02003, (no description) (inferred from 78% identity to app:CAP2UW1_3261)

MetaCyc: 48% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"ABC transporter ATP-binding protein YvcR"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL11 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Dsui_2307 putative ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component (Dechlorosoma suillum PS)
MEVVGLGKTVNNGDTPLTILHDIEFSVSAGETVAIVGASGSGKSTLLGLLAGLDSPSSGS
VRLDGENLNDLDEDARARLRGRMLGFVFQSFQLLPSLTAEENVMLPMELAGIREAAAKAR
QWLERVGLSQRLRHYPKHLSGGEQQRVALARAFALEPKLVLADEPTGNLDGQTGHQIVDL
MFKLNADQGTTLVLVTHDEEIAARCGRRLRMQEGKLIRE