Protein Info for Dsui_2303 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 138 to 167 (30 residues), see Phobius details amino acids 179 to 204 (26 residues), see Phobius details PF01891: CbiM" amino acids 2 to 208 (207 residues), 99.5 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: None (inferred from 58% identity to dar:Daro_1213)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QL07 at UniProt or InterPro

Protein Sequence (221 amino acids)

>Dsui_2303 putative membrane protein (Dechlorosoma suillum PS)
MNLPDNLLDPALHWLGWGLFAAVFLLALRRAPWGRLGDSAQSNVWLGTIVILTLLWSIKA
GVLPGLDLHLLGAMTFTLEFGPWLAFVGLSLVLAGITVNGAAGWESFGLNALVMAGLPVL
LAYGIYRFNQRRLSKNPFVFIFANGFFGSALTILATGVAASALLYLGGAYPLEKLLDDYL
PYFLLLGFSEAWLTGMVVTILVVYRPQWISTFDDSIYLAKK