Protein Info for Dsui_2261 in Dechlorosoma suillum PS

Annotation: putative flavin-nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details PF12900: Pyridox_ox_2" amino acids 38 to 176 (139 residues), 131.2 bits, see alignment E=1.4e-42

Best Hits

KEGG orthology group: K07005, (no description) (inferred from 70% identity to tmz:Tmz1t_1909)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKE1 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Dsui_2261 putative flavin-nucleotide-binding protein (Dechlorosoma suillum PS)
MSESQPSPNPSGPSASSSPSARTRVLRRPQRAAYDLASVAAIVDAGLLCTVAFQWEGSVH
AIPTLHWREGDHLYLHAAKASRLGQALLAGEACVSIALADGLVLARSAMHHSLNYRSVVI
YGRFEAVTEPEEKHRALRAFIEGLYPGRWEELRPMTAKEVNATAVLRLSLAEASAKVRQG
GPKDDAEDLAWPAWAGVIPLQRSQGEPVMEADSPLAEAPPTRFGRPGQDGAGVASVD