Protein Info for Dsui_2261 in Dechlorosoma suillum PS

Annotation: putative flavin-nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12900: Pyridox_ox_2
  • amino acids 38 to 176 (139 residues), 131.2 bits, E=1.4e-42

Best Hits

KEGG orthology group: K07005, (no description) (inferred from 70% identity to tmz:Tmz1t_1909)

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate biosynthesis I (6/7 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (5/9 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (7/12 steps found)
• pyridoxal 5'-phosphate salvage I (2/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

See G8QKE1 at UniProt or InterPro

Protein Sequence (237 amino acids)

>Dsui_2261 putative flavin-nucleotide-binding protein (Dechlorosoma suillum PS)
MSESQPSPNPSGPSASSSPSARTRVLRRPQRAAYDLASVAAIVDAGLLCTVAFQWEGSVH
AIPTLHWREGDHLYLHAAKASRLGQALLAGEACVSIALADGLVLARSAMHHSLNYRSVVI
YGRFEAVTEPEEKHRALRAFIEGLYPGRWEELRPMTAKEVNATAVLRLSLAEASAKVRQG
GPKDDAEDLAWPAWAGVIPLQRSQGEPVMEADSPLAEAPPTRFGRPGQDGAGVASVD