Protein Info for Dsui_2251 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 34 to 50 (17 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details PF00512: HisKA" amino acids 259 to 324 (66 residues), 91.7 bits, see alignment E=2.4e-30 PF02518: HATPase_c" amino acids 371 to 485 (115 residues), 103.7 bits, see alignment E=7.8e-34

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKD1 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Dsui_2251 signal transduction histidine kinase (Dechlorosoma suillum PS)
MDVVYLVYGLAFLLMGVVIVVRYDHRSHLQLSRILWMLAAFGFVHGFLEWTDLWREVRGD
VPWLAATRPFLLLLSYLFLFEFGRNLVLASLAPSPWQARVRWLLGPWLYFPMLLGVALGA
GLSAAPLLGMTIWSRYLGGFPASLLTGIGFYLYCRQVLLETMPAAEQRSIRLASNVAAGA
FILHAVLGGIVVPRADWFPPSLINQQTFLELFHVPVQLLRAACAVLVALAVMGLLKIFQL
ESLQRLQDALASAEQASRAKSEFVANMSHELRTPMNGVLGMAQVLRETPLDEEQREYVEV
INSSGESLLAIINDILDLSKIEAGRLDLESRDFDLGQQLAQVMELFAPQVRSKRLEMHLH
VEPDVPLKLRGDPGRLRQILVNLVANAVKFTARGEITLSVWREGESGGNVILRFAVSDTG
IGIPAEKIPQLFAPFTQVDGSIARKFGGTGLGLSISKHLVEMMGGCIGINSQAGQGATFW
FTVVLARGEA