Protein Info for Dsui_2249 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 152 to 173 (22 residues), see Phobius details PF08521: 2CSK_N" amino acids 20 to 145 (126 residues), 48.3 bits, see alignment E=2.2e-16 PF26769: HAMP_PhoQ" amino acids 173 to 219 (47 residues), 27 bits, see alignment 7e-10 PF00512: HisKA" amino acids 225 to 287 (63 residues), 55.9 bits, see alignment E=7.3e-19 PF02518: HATPase_c" amino acids 335 to 443 (109 residues), 72.2 bits, see alignment E=9.3e-24

Best Hits

KEGG orthology group: K07645, two-component system, OmpR family, sensor histidine kinase QseC [EC: 2.7.13.3] (inferred from 40% identity to bgf:BC1003_0630)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKC9 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Dsui_2249 signal transduction histidine kinase (Dechlorosoma suillum PS)
MMRTYSLRLRILFGILAAVALVWSVVGVIAYREARHEAEELLDAHLAQSATLLFAFLGDE
ADDIGERLPRHRYDKKVAFQVWEGERLLTRSPRAPDSRLSPREEGFSDVHIDGKAWRVFS
VRDARRHYLIQVADAAESRAEISNEVASHLLQTMGVGLPVLGLVLGIFVLLAFRPLSRLA
DSIGAQAPQRLQPISLAEAPREVVPILERLNRLFEQVRRAQDDERRFTADAAHELRTPLA
VLQTHAEVAQAAGDDATRQRALDHLVSGSRRAARLVDQLLTLARLDAQAELPDQEACPLR
RLAVETVASLAPAGFDKGVELEVEEGPEISVTGSPLLLQVLLRNLLDNAIRHTPAGGRVL
VCCQAQGDGGADAVLHVRDSGPGIPAEQRQEALARFRRLDPGAGDGHGLGLSIVTRIAEL
HGARLSLGAAADLGGLDVAIAFPVRARQPSPPLGD