Protein Info for Dsui_2237 in Dechlorosoma suillum PS

Annotation: ABC-type dipeptide/oligopeptide/nickel transport system, permease component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 28 (17 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 130 to 155 (26 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 242 to 268 (27 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 2 to 100 (99 residues), 35.1 bits, see alignment E=1.4e-12 PF00528: BPD_transp_1" amino acids 111 to 318 (208 residues), 136.9 bits, see alignment E=6.9e-44

Best Hits

Swiss-Prot: 41% identical to APPB_BACSU: Oligopeptide transport system permease protein AppB (appB) from Bacillus subtilis (strain 168)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 62% identity to rso:RSc2869)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QKB7 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Dsui_2237 ABC-type dipeptide/oligopeptide/nickel transport system, permease component (Dechlorosoma suillum PS)
MTFILRRLLHGAWVLLAVSALVFAALYVVGNPVELLVDPQADPADTARTIAALGLDQPLW
RQYLTFLGNAARGDLGTSFIHGVPALSLILERLPATLELAASALFLALLLGIPLGLWAGL
RPTSLAGRLIGAASTLGFALPAFWVGLMLILVFAVQLQWLPPGGRGETREVLGLSLSVFT
LDGWRHLLLPALNLALYKAALVVRLVRAGSREALAQDYVRFARAKGLTESRVVTGHVLPN
TLIPVVTVLGMELGALIAFAVVTETVFGWPGMGKLLMDAINALDRPVVVAYLLFAAALFV
VLNLLVELLYGWLDPRVREGRQ