Protein Info for Dsui_2192 in Dechlorosoma suillum PS

Annotation: squalene synthase HpnD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 TIGR03465: squalene synthase HpnD" amino acids 10 to 275 (266 residues), 395.3 bits, see alignment E=5.3e-123 PF00494: SQS_PSY" amino acids 13 to 263 (251 residues), 294.7 bits, see alignment E=3.8e-92

Best Hits

KEGG orthology group: K02291, phytoene synthase [EC: 2.5.1.32] (inferred from 70% identity to dar:Daro_2706)

Predicted SEED Role

"Phytoene synthase (EC 2.5.1.32)" in subsystem Carotenoids (EC 2.5.1.32)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.32

Use Curated BLAST to search for 2.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJT4 at UniProt or InterPro

Protein Sequence (277 amino acids)

>Dsui_2192 squalene synthase HpnD (Dechlorosoma suillum PS)
MNPHDYCQQKAAASGSSFTISFTLLPREKKQAMTALYAFCREVDDVVDEVEDPQVAAIKL
AWWRQEVERLYDGTPQHPVAQALAEVIKTIPLDKELLLEIIDGMEMDLTQARYADFKSLQ
LYCYRVASVVGLLSAEIFGMTQRATRKYAHDLGMAFQLTNIIRDVGEDARRGRIYLPMDE
LQRFNVPAADILNSRPTEAFAALMQFQIERARGFYEQAFAALPAADRRQQKPGLVMAAIY
RSLLEEIAAEPELVLTHRISIPPGRKAWLALKAWIKG