Protein Info for Dsui_2171 in Dechlorosoma suillum PS

Annotation: Protein of unknown function (DUF3325)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 98 to 116 (19 residues), see Phobius details PF11804: DUF3325" amino acids 10 to 110 (101 residues), 89.1 bits, see alignment E=9.7e-30

Best Hits

KEGG orthology group: None (inferred from 33% identity to bav:BAV1212)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJR3 at UniProt or InterPro

Protein Sequence (118 amino acids)

>Dsui_2171 Protein of unknown function (DUF3325) (Dechlorosoma suillum PS)
MNISWLHAAASLGLAYLGMLGLCLGMARHYRQRYHHPLTPGRGRVLRLAGWSGCLLALAP
CLAGWGAAQGVVLWIGLLSAAATGLVFLLAWRPPWCTRGGALAVLTVLAWLGSLASGG