Protein Info for Dsui_2159 in Dechlorosoma suillum PS

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details PF00015: MCPsignal" amino acids 208 to 345 (138 residues), 84.7 bits, see alignment E=3.5e-28

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 36% identity to azo:azo0410)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJQ1 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Dsui_2159 methyl-accepting chemotaxis protein (Dechlorosoma suillum PS)
MRDNNSSLEESLEASRLFKRGILAFLSIAAATGAAVYGGHEAFHRFAENSLGLSDRVVDT
LGSMCIVVVAFCVHYAISRLFYRDFLLGSRVAAEHLQQRSRERLACAAELAGRVREVGRV
GELTREQLGQLVQITEGAARDIIVQCENLDATMGDLKQMVSQADELSARLTEDTEARMAH
NRTVISRLEQYIEERVSESAEDQQRTSRVIGETRALGGLVEVIRHISGQTNLLALNAAIE
AARAGEAGRGFAVVATEVRKLSGEVDQAATQIHAGISAMAQSIQSQFEHKLAGTHVDAER
TSLQAITAQLEGLAEGIQQAISGEANSVRLICDGAAMLDQAILQVMSSIQFQDITRQQIE
RIQEGMLRMEDYVQSLVLQLESLESLEACHPREEPLDQLVQGLYASITGSSKAPAGGLVE
LF