Protein Info for Dsui_2146 in Dechlorosoma suillum PS

Annotation: integration host factor, beta subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 TIGR00988: integration host factor, beta subunit" amino acids 1 to 92 (92 residues), 132 bits, see alignment E=4e-43 PF00216: Bac_DNA_binding" amino acids 1 to 90 (90 residues), 108.5 bits, see alignment E=1.7e-35 PF18291: HU-HIG" amino acids 13 to 93 (81 residues), 28.7 bits, see alignment E=1.2e-10

Best Hits

Swiss-Prot: 71% identical to IHFB_DECAR: Integration host factor subunit beta (ihfB) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K05788, integration host factor subunit beta (inferred from 71% identity to dar:Daro_1281)

Predicted SEED Role

"Integration host factor beta subunit" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJN8 at UniProt or InterPro

Protein Sequence (107 amino acids)

>Dsui_2146 integration host factor, beta subunit (Dechlorosoma suillum PS)
MTKSELVADLTGKLPHLTTRDVDFAVNLMLDAIAEALTRGDRVEIRGFGSFSLNYRPARQ
GRNPKTGEQVEVPAKHVPHFKAGKELRERVQEAAEAAARDQRLRQAA