Protein Info for Dsui_2137 in Dechlorosoma suillum PS

Annotation: queuosine biosynthesis protein QueD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 148 PF01242: PTPS" amino acids 3 to 144 (142 residues), 107.1 bits, see alignment E=3e-35 TIGR03367: queuosine biosynthesis protein QueD" amino acids 3 to 116 (114 residues), 94.6 bits, see alignment E=1.9e-31

Best Hits

KEGG orthology group: K01737, 6-pyruvoyl tetrahydrobiopterin synthase [EC: 4.2.3.12] (inferred from 78% identity to app:CAP2UW1_1018)

Predicted SEED Role

"6-carboxytetrahydropterin synthase (EC 4.1.2.50) @ Queuosine biosynthesis QueD, PTPS-I" (EC 4.1.2.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.50 or 4.2.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ86 at UniProt or InterPro

Protein Sequence (148 amino acids)

>Dsui_2137 queuosine biosynthesis protein QueD (Dechlorosoma suillum PS)
MLITRRLEFDAGHRIPDHRSQCRHLHGHRYVLEITLAGDIISKDGDPANGMVMDFSDVKA
LAKAHVVDVWDHAFLVYAGDKAVVEFLQTLPDHKTVVLDCIPTAENLSETAFRILDAVYQ
DSYGNHLRLQQVRLYETPNCWADAVRRD