Protein Info for Dsui_2135 in Dechlorosoma suillum PS

Annotation: putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF01381: HTH_3" amino acids 13 to 49 (37 residues), 24.2 bits, see alignment E=2.8e-09 PF22495: HTH_92" amino acids 13 to 57 (45 residues), 94.2 bits, see alignment E=2.3e-31

Best Hits

KEGG orthology group: None (inferred from 82% identity to app:CAP2UW1_0496)

Predicted SEED Role

"FIG00858571: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ84 at UniProt or InterPro

Protein Sequence (101 amino acids)

>Dsui_2135 putative transcriptional regulator (Dechlorosoma suillum PS)
MSNVKLVEKIDPREIRRKLGLNQQQFWSKIGVTQSGGSRYESGRNMPKPVRELLRLVHVE
QVDIQRIKREDIEVVEYLKAFEPETLKNLKKAAKAKQKKAA