Protein Info for Dsui_2119 in Dechlorosoma suillum PS

Annotation: uncharacterized protein SCO1/SenC/PrrC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF13899: Thioredoxin_7" amino acids 39 to 129 (91 residues), 31.3 bits, see alignment E=3.7e-11 PF13098: Thioredoxin_2" amino acids 41 to 154 (114 residues), 64.9 bits, see alignment E=1.8e-21 PF00578: AhpC-TSA" amino acids 193 to 280 (88 residues), 30.1 bits, see alignment E=8.4e-11 PF02630: SCO1-SenC" amino acids 193 to 328 (136 residues), 111.9 bits, see alignment E=4.6e-36

Best Hits

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ71 at UniProt or InterPro

Protein Sequence (378 amino acids)

>Dsui_2119 uncharacterized protein SCO1/SenC/PrrC (Dechlorosoma suillum PS)
MPSPSRTLGLLALLAALASATAGAGEARFSPLFTREATDLQAEARAARAEGRKLAVAFTL
PDCPGCREMERTVFQDPGVTARFSRHYRSVKVDLARSEPILDLAGRRGSAADFARQLGAF
ATPSFAFFDGRGEFLYRHTGTLAAADFSRLGQYVAKAEYEQYPFAGARARAAQAANAPRL
QADTPAAGLPRRPEFRLADTAGKVRRLADFRGRAVALAVGYSQCPDVCPTTLAELKAAVE
ALPAAQRRQVQVLFVTLDPERDHAALLREYVAAFAPQGGRPFLGLWGGDGATADLIRELQ
LVAERQPSESMGYTLDHTAGVFLFDKAGVLRGLSPYGQPVGALAADLGLLAAEPKHSDKT
IQVATDQHLTQGNPRHVH