Protein Info for Dsui_2118 in Dechlorosoma suillum PS

Annotation: acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF01144: CoA_trans" amino acids 37 to 235 (199 residues), 46.7 bits, see alignment E=1.3e-16

Best Hits

KEGG orthology group: K01039, glutaconate CoA-transferase, subunit A [EC: 2.8.3.12] (inferred from 68% identity to rpa:RPA2318)

Predicted SEED Role

"Possible glutaconate CoA-transferase, subunit A (EC 2.8.3.12)" (EC 2.8.3.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.3.12

Use Curated BLAST to search for 2.8.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ70 at UniProt or InterPro

Protein Sequence (335 amino acids)

>Dsui_2118 acyl CoA:acetate/3-ketoacid CoA transferase, alpha subunit (Dechlorosoma suillum PS)
MSINKLLPLAEAAQRYAGDGIQYASGAGLPVGADAIAFGRELVRQGRRNLHALFHCNTQQ
LNLLAAAGTVDKAEVGFSGLEGFGFANGLRRVVEEGKLALEDYSNLAMALRFLGGALNWP
FVPATTCIGSDIQQRSAFAPEEYPATGKIPEIADPFSGRTLGAYSPLKPDLAVIHVTLAD
PEGNAIMIGSEWSRFELSRAAKRLVLVADHIVDTDCMRQYPNLVRIPGLIVDAVVWWPFS
AWPAASPGVHDVDEAHMRLMNEWLATEEGTFRYIDRYIFSYQTVDAYLNLIGQDVISKLE
DSPTRFLLDPYRQWILDRAKVEQLQAENHILKRAA