Protein Info for Dsui_2099 in Dechlorosoma suillum PS

Annotation: RNA polymerase sigma factor, sigma-70 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 27 to 189 (163 residues), 64.9 bits, see alignment E=3.4e-22 PF04542: Sigma70_r2" amino acids 30 to 93 (64 residues), 49.5 bits, see alignment E=3.1e-17 PF08281: Sigma70_r4_2" amino acids 133 to 173 (41 residues), 26.8 bits, see alignment 3.3e-10

Best Hits

KEGG orthology group: None (inferred from 67% identity to slt:Slit_0929)

Predicted SEED Role

"DNA-directed RNA polymerase specialized sigma subunit, sigma24-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ52 at UniProt or InterPro

Protein Sequence (197 amino acids)

>Dsui_2099 RNA polymerase sigma factor, sigma-70 family (Dechlorosoma suillum PS)
MDTSFSLSLPRDETRLMAEQNRRLTEAIARESGRLGSFIRRRVPDPGEAEDILQDVFFEL
VEAWRLPEPIEQVGAWLFRVARHRIVDRFRKRREEPLPVAVQEDGDEEHWLEAALPADDG
GPEAAYLRRLWLDAIATALEELAPGPRETFIAHEIDGRSFKEMAAESGVPMNTLLGWKRQ
AVLHLRQRLRPLYEPQS