Protein Info for Dsui_2088 in Dechlorosoma suillum PS

Annotation: cytochrome c

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF21342: SoxA-TsdA_cyt-c" amino acids 92 to 170 (79 residues), 29.3 bits, see alignment E=1.1e-10 PF00034: Cytochrom_C" amino acids 192 to 274 (83 residues), 41.9 bits, see alignment E=3.1e-14 PF13442: Cytochrome_CBB3" amino acids 192 to 271 (80 residues), 44.9 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 66% identical to TSDA_PSEU5: Thiosulfate dehydrogenase (tsdA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: None (inferred from 80% identity to pnu:Pnuc_0786)

Predicted SEED Role

"FIG002261: Cytochrome c family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ41 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Dsui_2088 cytochrome c (Dechlorosoma suillum PS)
MKNAKILAALLGSICLFAGVAQAADTANTLRNSRLDDQTQLPKAPAKPVSQQYFQPPADT
DIPNNAFGELVRRGQDLFMNTKALAPEYVGNEMNCVNCHIDRGRKANSAPLWAAYPMYPA
YRKKNNKVNTYVERMQGCFQFSMNGKPPAADSEILTALTTYAYWLSTGAPTGKALPGRGF
DEPPPPKGGYDIARGKAVYEKQCQLCHGENGEGKKVGVTSVFPALWGKDSYNWGAGMHRI
NTAAGFIQHNMPLGRGETLSDQEAWDVAAYINSHERPQDPRLVNGSIDETRKRYHADDGV
NLYGVVVNGKKLGQGVQ