Protein Info for Dsui_2082 in Dechlorosoma suillum PS

Annotation: alkylhydroperoxidase AhpD family core domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 PF02627: CMD" amino acids 12 to 94 (83 residues), 74.3 bits, see alignment E=3.1e-25 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 29 to 77 (49 residues), 54.1 bits, see alignment E=4e-19

Best Hits

Swiss-Prot: 36% identical to YDFG_BACSU: Uncharacterized protein YdfG (ydfG) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 80% identity to eba:ebA6752)

Predicted SEED Role

"4-carboxymuconolactone decarboxylase domain/alkylhydroperoxidase AhpD family core domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ35 at UniProt or InterPro

Protein Sequence (146 amino acids)

>Dsui_2082 alkylhydroperoxidase AhpD family core domain protein (Dechlorosoma suillum PS)
MEQRFDIGKLIPDGYKAMFGVHTYVQGAGLDLGLLELVRLRVSQINGCAFCVAMHVPLAR
KYGLSENQINLTATWKEAPVFDPRQRAALAWAEAVTALSGQEVPDAIYEEVKAHFSPVEI
ANLTLCVVEINGWNRLMVASRTPPLL