Protein Info for Dsui_2075 in Dechlorosoma suillum PS

Annotation: nucleotidyltransferase/DNA polymerase involved in DNA repair

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 360 to 378 (19 residues), see Phobius details PF00817: IMS" amino acids 14 to 178 (165 residues), 135.6 bits, see alignment E=2e-43 PF21999: IMS_HHH_1" amino acids 207 to 255 (49 residues), 31.5 bits, see alignment 2.9e-11 PF11799: IMS_C" amino acids 265 to 371 (107 residues), 91.8 bits, see alignment E=6e-30

Best Hits

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 76% identity to dar:Daro_2123)

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QJ28 at UniProt or InterPro

Protein Sequence (387 amino acids)

>Dsui_2075 nucleotidyltransferase/DNA polymerase involved in DNA repair (Dechlorosoma suillum PS)
MPAAVLPERRIAHLDMDAFFASVELLHYPELRGRPVVVGGRAVDRPRRQADGSLHFARLR
DYVGRGVITTSTYEARALGVFSGMGLMKAAQLAPDAILLPANFDAYRDYSRRFKAAVAAI
APCIEDRGIDEIYIDLSHIEEATLPLARRLKAAVLAATGLTCSIGITPNKLLSKICSDLD
KPDGITVLGMEEVPTRIWPLVAKKINGIGPKANERLGQLGIHSIGDLAAAPPEMLVQHFG
RSTGAWLHRAAHGIDERPLSTSREPKSISRESTFSRDLHARHDRAELSEIFTGMCLRVAD
DLARQGYVARTIGIKLRYADFQSVTRDLTLAVPTADGAAIRKAAGECLKRVPLQQRLRLL
GVRASSLLPAAAAAALPAPLVQAELPL