Protein Info for Dsui_2063 in Dechlorosoma suillum PS

Annotation: protein chain release factor B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 PF00472: RF-1" amino acids 2 to 126 (125 residues), 77 bits, see alignment E=5.7e-26

Best Hits

Swiss-Prot: 57% identical to ARFB_PSEPU: Peptidyl-tRNA hydrolase ArfB (arfB) from Pseudomonas putida

KEGG orthology group: K15034, ribosome-associated protein (inferred from 85% identity to dar:Daro_0536)

MetaCyc: 56% identical to peptidyl-tRNA hydrolase, ribosome rescue factor (Escherichia coli K-12 substr. MG1655)
Aminoacyl-tRNA hydrolase. [EC: 3.1.1.29]

Predicted SEED Role

"Hypothetical protein YaeJ with similarity to translation release factor"

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.29

Use Curated BLAST to search for 3.1.1.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIM2 at UniProt or InterPro

Protein Sequence (132 amino acids)

>Dsui_2063 protein chain release factor B (Dechlorosoma suillum PS)
MSITLNESEVEIVAIRAQGAGGQNVNKVSNAVHLRFDVGASSLPEEIKARLLARRDQRLS
SDGVIVIKAQKHRSLERNREDALVRLREMIAAAAFVPAQRRPTKPSRSSQRKRVDSKVKR
GLVKLQRGRVSE