Protein Info for Dsui_2062 in Dechlorosoma suillum PS

Annotation: FKBP-type peptidyl-prolyl cis-trans isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00254: FKBP_C" amino acids 43 to 131 (89 residues), 105.5 bits, see alignment E=7.7e-35

Best Hits

KEGG orthology group: K03772, FKBP-type peptidyl-prolyl cis-trans isomerase FkpA [EC: 5.2.1.8] (inferred from 69% identity to ajs:Ajs_1935)

Predicted SEED Role

"FKBP-type peptidyl-prolyl cis-trans isomerase FkpA precursor (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase or Potassium homeostasis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIM1 at UniProt or InterPro

Protein Sequence (135 amino acids)

>Dsui_2062 FKBP-type peptidyl-prolyl cis-trans isomerase (Dechlorosoma suillum PS)
MQLWQKLMLTAVAALAAAGVQAGAPEKTPSGLVYESLKDGSGEKAAPELTVQVHYRGTLA
NGSEFDSSYKRGQPATFPLNRVIPCWTEGVSKMREGGKARLTCPPEIAYGSRGAGSAVPP
NATLTFEVELLKVIR