Protein Info for Dsui_2049 in Dechlorosoma suillum PS

Annotation: ABC-type uncharacterized transport system, permease and ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 567 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 173 to 196 (24 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details PF06472: ABC_membrane_2" amino acids 23 to 280 (258 residues), 184.9 bits, see alignment E=3e-58 PF05992: SbmA_BacA" amino acids 25 to 330 (306 residues), 53.7 bits, see alignment E=3.5e-18 PF00005: ABC_tran" amino acids 372 to 509 (138 residues), 74.7 bits, see alignment E=1.7e-24

Best Hits

KEGG orthology group: K02471, putative ATP-binding cassette transporter (inferred from 73% identity to dar:Daro_0045)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIK8 at UniProt or InterPro

Protein Sequence (567 amino acids)

>Dsui_2049 ABC-type uncharacterized transport system, permease and ATPase component (Dechlorosoma suillum PS)
MKSVDRHLWQRFTGIAAPYWRSEEKWKAWGLLVLLVLLLLGQTRFAVLFNEQTGEFTSAL
AARDEPRFWDAIQLCLVLLAVAVPIYGFYYYVRDKLGLHWRRWLTHRFLDNYFSHRHFYE
LNAETAIDNPDQRIAEDINTFTQRSLFFLLIFIGAVLQLAAFSHVLWSISRDLVYFLVVY
ALAGTLITIFVFGKPLIGLNFHQLRKEADFRFSLVRVRENAESIAFYRGEAQEAHQVKQR
FAKAFNNFNKLIRKQLSLNLFQYAYTLLTMVLPAAIISSRVLSGELEVGRAIQAAGAFAA
VLGAISVIVENFEGLSRFAAGVDRLDAFARIMSGQLPEQHRSAGHIELLEEPRLSLERVT
LQTPDDGRVLVRDLSLQITPGEGLLIVGESGSGKSSLLRAIAGLWSVGSGSITCPPSEDI
LFLPQQPYMLLGTLRSQLLYPKREQHISDAELLHLLERVNLPDLAGRVGGLHVERDWGKV
LSVGEQQRLAFARVLLSKPRYAMLDEATSALDIANEESLYRTLATTDTTLISVGHRTTIL
KYHRQVLELTGNGQWQRHRAESYRFMQ