Protein Info for Dsui_2048 in Dechlorosoma suillum PS

Annotation: ATPase component of ABC transporters with duplicated ATPase domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 560 PF00005: ABC_tran" amino acids 17 to 178 (162 residues), 84 bits, see alignment E=3.1e-27 amino acids 339 to 480 (142 residues), 81.7 bits, see alignment E=1.6e-26 PF12848: ABC_tran_Xtn" amino acids 217 to 296 (80 residues), 100.6 bits, see alignment E=8.3e-33

Best Hits

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 85% identity to dar:Daro_3856)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIK7 at UniProt or InterPro

Protein Sequence (560 amino acids)

>Dsui_2048 ATPase component of ABC transporters with duplicated ATPase domain (Dechlorosoma suillum PS)
MITLKNIVLRRGTKVVLDRASVTINPGEKVGLVGRNGAGKSSLFALLNGNLHEDGGDVSI
PSQWRMAQVAQDMPETEQSATDFVIEGDTVLLAAQQEVAAAEASDDGMRMAHAYTALYDA
GAHDAPARAQALILGLGFHVDELSQPVNSFSGGWRMRLQLARALMCPSDLLLLDEPTNHL
DLDALVWLEAWLKRYTGTLVMISHDREFLDAITNVTLHIDNAKLVRYGGNYSTFEDMRAE
QMLLQQATLAKQQEKIAHLQKFIDRFKAKASKAKQAQSRVKALERMEKIAPVLADAEFTF
EFKEPLNLPNPMLSLLGADIGYPPAEDAAPGTPPTVIVRGINRSVHAGQRIGILGANGQG
KSTLVKTIARDLAPIAGDLTEGKGLNIGYFAQQELDVLRPEDTPLEHMIRLAKEVIAAGR
SGYVAGKEQDLRNFLGTFNFSGDMVKQPVGTMSGGEKARLVLCMIVWQRPNLLLLDEPTN
HLDLSTREALSVALNEFEGTVMLVSHDRALLRSVCDEFWLVADGAVGPYDGDLDDYQRYL
LDEARRAREAASASRRQVEA