Protein Info for Dsui_2046 in Dechlorosoma suillum PS

Annotation: PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 PF00072: Response_reg" amino acids 13 to 121 (109 residues), 73.8 bits, see alignment E=4.3e-24 TIGR00229: PAS domain S-box protein" amino acids 135 to 253 (119 residues), 76.6 bits, see alignment E=1.8e-25 amino acids 258 to 382 (125 residues), 88.1 bits, see alignment E=5e-29 PF00989: PAS" amino acids 137 to 246 (110 residues), 43.5 bits, see alignment E=1e-14 amino acids 262 to 366 (105 residues), 39.7 bits, see alignment E=1.5e-13 PF13188: PAS_8" amino acids 137 to 198 (62 residues), 40.8 bits, see alignment E=5e-14 amino acids 262 to 313 (52 residues), 32.1 bits, see alignment 2.6e-11 PF08448: PAS_4" amino acids 142 to 250 (109 residues), 44.8 bits, see alignment E=4.8e-15 amino acids 271 to 378 (108 residues), 38.8 bits, see alignment E=3.4e-13 PF13426: PAS_9" amino acids 147 to 248 (102 residues), 61.8 bits, see alignment E=2.3e-20 amino acids 271 to 375 (105 residues), 55.7 bits, see alignment E=1.8e-18 PF08447: PAS_3" amino acids 160 to 242 (83 residues), 32 bits, see alignment E=4.1e-11 amino acids 286 to 365 (80 residues), 35.6 bits, see alignment E=3.1e-12 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 385 to 550 (166 residues), 153.9 bits, see alignment E=3.3e-49 PF00990: GGDEF" amino acids 387 to 546 (160 residues), 171 bits, see alignment E=6.3e-54

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIK5 at UniProt or InterPro

Protein Sequence (559 amino acids)

>Dsui_2046 PAS domain S-box/diguanylate cyclase (GGDEF) domain-containing protein (Dechlorosoma suillum PS)
MTLAPPPGFRTLLLVDDEPALLNALKREFRSAPYEVLTATSGEEALAVLADRDVQVILSD
YRMPGMSGVEFLAQARALRPDAVRMVLSGYADIGAVIAAINQGNIYKFLNKPWDGEELRA
VTAQAFAHHALVRRGAQFSQIFENTSEGIFILDREGRFETVNGAFCAITGYSEADIVGQD
HHCLLLPQPGRPTPEFMQELADGGHWRGELWLQRRDGQVFPAALTLSPVCDGNRRLVQVV
GLCADITERKGREIALLESEKRFRDFMEFAPVGMAIVNLDGRLGKVNQALCQILGYSREA
LERLSFEDLTPDEDLAADLAMWRRLRQGEMPVWQAEKRYLRSDGSPVWVELTAAVLRSTQ
GVAQCFDVQVEDISERRRDQEKIRQLAYFDALTGLPNRRLLQDRLEQALLRARRHQQQVG
VLFLDLDHFKQVNDVHGHEVGDELLSAAARRLTRCVRQGDTVARQGGDEFIVVLAEVGAP
AGVIRAAETIIASLAAPYELGQARIRVDVITASVGIALFPAHGSDSQTLMKHADLAMYAA
KQAGRNGYRIYDEGLAPGG