Protein Info for Dsui_2034 in Dechlorosoma suillum PS

Annotation: DNA gyrase inhibitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF12833: HTH_18" amino acids 33 to 113 (81 residues), 69.9 bits, see alignment E=3.8e-23 PF00165: HTH_AraC" amino acids 76 to 112 (37 residues), 40 bits, see alignment 6.7e-14 PF06445: GyrI-like" amino acids 135 to 288 (154 residues), 118.5 bits, see alignment E=6.9e-38 PF14526: Cass2" amino acids 137 to 286 (150 residues), 44.8 bits, see alignment E=3.1e-15

Best Hits

KEGG orthology group: K13652, AraC family transcriptional regulator (inferred from 67% identity to mei:Msip34_2483)

Predicted SEED Role

"Uncharacterized protein ygiV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIJ3 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Dsui_2034 DNA gyrase inhibitor (Dechlorosoma suillum PS)
MNDDRISRYAARFDKVLAYIEAHLDEPLTAERLSRVAHFSRFHFDRQFADFLGTSATRYL
LLLRLRRASFKLAFQPRIRIIDIALEAGFENPESFSRAFRHIFGQSPSQFRRQPDWQGWS
ERYRFRLPERNATVQVEIVEIESTLIAALEHLGPAEKVNDSVARFIDWRKSTGLSPKDSS
RTFGIAYDNPDTTEPSRFRFDIAGEVQAQVPPNAQGVVTKEIPCGRCARVRHLGSHMRIG
ESIYPLYRNWLPGSGEELRDFPLFFHYLNLLPDTPENELVTDIYLPLK