Protein Info for Dsui_2025 in Dechlorosoma suillum PS

Annotation: RND family efflux transporter, MFP subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 45 to 372 (328 residues), 288.3 bits, see alignment E=3.2e-90 PF25917: BSH_RND" amino acids 70 to 210 (141 residues), 78.9 bits, see alignment E=5.3e-26 PF25876: HH_MFP_RND" amino acids 110 to 179 (70 residues), 46.7 bits, see alignment E=7.7e-16 PF25954: Beta-barrel_RND_2" amino acids 241 to 298 (58 residues), 34.3 bits, see alignment E=5.7e-12 PF25944: Beta-barrel_RND" amino acids 241 to 295 (55 residues), 47.3 bits, see alignment 5.9e-16 PF25967: RND-MFP_C" amino acids 303 to 363 (61 residues), 42.5 bits, see alignment E=1.3e-14

Best Hits

Swiss-Prot: 33% identical to MDTA_ENT38: Multidrug resistance protein MdtA (mdtA) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 78% identity to dar:Daro_3829)

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QII4 at UniProt or InterPro

Protein Sequence (395 amino acids)

>Dsui_2025 RND family efflux transporter, MFP subunit (Dechlorosoma suillum PS)
MPQLKKRLIIAAALAGLAGLGGTAAVFYAHAGGAPAMAAPAAASVEVAEVASRPVTDWQS
YSGRLEAVERVELRPQVSGVLTAVHFKDGSLVKKGDLLFSIDPRPFAAEVARAQAQLAGA
EARAAYTGADLARGERLLAENAVSRRDFEEKQNAAREAAATLKAAQAALKVAELNLEYTR
ITAPISGRMSRAEVTVGNLVAPGNAAPLTTLVSADSIYAAFDVDEQSYLKYVSGSQGKGL
PIRMGLADESGHGREGRLSSVDNRLDSTSGTIRLRAVFDNPDGRLVPGLYARVRLGSEAP
REAVLVDEKAVGTDQDKRFVLVVDGKNRTAYREVRLGAVQEGLRVVESGLKAGERIVVNG
LQRVRPGDEVAPQMVSMGGRETAGVARAASPADKG