Protein Info for Dsui_2024 in Dechlorosoma suillum PS

Annotation: esterase/lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF20434: BD-FAE" amino acids 28 to 134 (107 residues), 53.2 bits, see alignment E=5.8e-18 PF00135: COesterase" amino acids 29 to 135 (107 residues), 29.1 bits, see alignment E=1e-10 PF07859: Abhydrolase_3" amino acids 41 to 245 (205 residues), 199.9 bits, see alignment E=8.8e-63 PF00326: Peptidase_S9" amino acids 90 to 265 (176 residues), 25.2 bits, see alignment E=2.2e-09

Best Hits

KEGG orthology group: None (inferred from 77% identity to dar:Daro_3830)

Predicted SEED Role

"Esterase/lipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QII3 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Dsui_2024 esterase/lipase (Dechlorosoma suillum PS)
MDAIPGAPATLVEDFTIPGPQGAIPARLYRPRTGGRPLPVVLYFHGGGFVGGCLDDADVP
ARFLAARVPALVLAVGYALAPARPFPAAPEDAHAAALWLAQQAAALGGDASRLAVAGDDA
GGNLAACLTLMARDRNAPAIAAQVLVGPMLDPSMTRLGDGQRLNSDLSAADCAACYRQYL
PQPRQRLHPYASPLASVRQAGLPPALVLTAECDVLHQEAEQYAAALIEAGVPTQVARFPG
VTHAALARHPPALAEIAHFLGHRLGAGMAVAPNQ