Protein Info for Dsui_2006 in Dechlorosoma suillum PS

Annotation: putative sodium:solute symporter, VC_2705 subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 680 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 218 to 236 (19 residues), see Phobius details amino acids 370 to 394 (25 residues), see Phobius details amino acids 406 to 426 (21 residues), see Phobius details amino acids 491 to 517 (27 residues), see Phobius details amino acids 538 to 558 (21 residues), see Phobius details amino acids 564 to 588 (25 residues), see Phobius details amino acids 595 to 613 (19 residues), see Phobius details amino acids 633 to 659 (27 residues), see Phobius details TIGR03648: probable sodium:solute symporter, VC_2705 subfamily" amino acids 44 to 677 (634 residues), 784.3 bits, see alignment E=5.5e-240 PF00474: SSF" amino acids 69 to 227 (159 residues), 106.6 bits, see alignment E=7.3e-35 amino acids 489 to 604 (116 residues), 72.5 bits, see alignment E=1.6e-24

Best Hits

KEGG orthology group: K14393, cation/acetate symporter (inferred from 76% identity to app:CAP2UW1_3752)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIG6 at UniProt or InterPro

Protein Sequence (680 amino acids)

>Dsui_2006 putative sodium:solute symporter, VC_2705 subfamily (Dechlorosoma suillum PS)
MPTAKGFRQQLKRYYLLYTVGFLAFVAVLAFLEHLGLPPRWIGYAFLLFTILIYATIGVM
SRTADVSEYYVAGRRVPALFNGMATGADWMSAASFIGMAGTLYLTGYQGLAYIMGWTGGY
VLVALFLAPYLRKFGQYTIPDFLAVRYGGNAPRLVGVAAAIIASFVYVVAQIYGVGLITS
RFVSLQFEIGVFVGLAGILVCSFLGGMRAVTWTQVAQYVILIIAYVTPVALLSFQITSVP
VPQLVYGEVLQEVGKLEEKLFETPAEQEVRGLYRERADAYYEKIMRLPVSLAEERQRLTM
RINALKEENAPMREVVALERLRRDLPANAEEARERWDAAMHAAADRGAMPIRHAEAFPGR
SEAESSAARLNFLTLMFCLMVGTAALPHVLMRYYTTPTVKEARESVTWSLFFILLLYFTA
PAYAVFAKYEVYSTLINTPIAHLPSWVAAWGKVGLVAIEDINHDGLLQLAELSLNPDVIV
LATPEIAGLPYVISGLVAAGGLAAALSTADGLLLTIAGSLSHDVYYKIIQPRASTQWRLV
ISKSLLLVTAVLAATVAAQRPATILYMVAWAFSIAAAAFFPALVIGIFWKRANRAGAVSG
MVVGLLITVYYMVRVQFDSVPWLGLRGIGMEPWFGIQSTSAGVWGVPAGFLTIVVVSLLT
KPPSREVQDFVEQVHYPQLR