Protein Info for Dsui_2004 in Dechlorosoma suillum PS

Annotation: putative signal-transduction protein containing cAMP-binding and CBS domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 636 PF00571: CBS" amino acids 175 to 224 (50 residues), 40.9 bits, see alignment 3.1e-14 amino acids 235 to 287 (53 residues), 39.3 bits, see alignment 1e-13 PF03445: DUF294" amino acids 315 to 453 (139 residues), 150 bits, see alignment E=5.9e-48 PF10335: DUF294_C" amino acids 491 to 634 (144 residues), 148.1 bits, see alignment E=2.5e-47

Best Hits

KEGG orthology group: K07182, CBS domain-containing protein (inferred from 64% identity to app:CAP2UW1_3754)

Predicted SEED Role

"Predicted signal-transduction protein containing cAMP-binding and CBS domains" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QIG4 at UniProt or InterPro

Protein Sequence (636 amino acids)

>Dsui_2004 putative signal-transduction protein containing cAMP-binding and CBS domains (Dechlorosoma suillum PS)
MSTNATQMLVSATMEFLRRHSPFDRMEGDALRFLAERLKLAYYHKDAAILTPDMGAARTF
YIIQRGKVVARQAGEVNVTEYNAMTLGPGECFPIGAVTAQRASTNGYTAIEDVFCYQLAA
DDFFELMRMSSVFNLFCTQYIASLLNQSRQQLQVQFAQRAAEQQSLNTPLSLLAKREPVS
VQPETPLRQVLEAMGQQRLGSMIVTDAEGKPVGIFTQSDVLHRVVLAGVALEEPISKVMS
KDPHTLQDTVYAYDAALAMAMHGIRHVLVVDGEGRLKGVISERDLFTLQRVGLRQIRQSV
ETAPDLETLLQTSQDVRQLALNMLAQGVGAEQVTQFISALNDTITRRVLELNLDKHDLYG
VDWAWLSFGSEGREEQTFSTDQDNGIIYLCPDFMDKEQLKMRLLDFARDVNDDLDKCGFP
LCSGNIMAGNPDLCLTLEEWEEKFTNWVRHPHPAALLNATIFFDFRTLYGNPSLGERLRK
WMLSLTTSNPGFLKMMAHNALHVEPPLGKIRDFVTDLDPEHPGTIDLKKYGARLFVDIAR
IYALAAGIHNSNTVQRLRHSAKRLGISGEEMAAIIDSFNFIQLLRLRHQHLETEAGQAGD
NRIHPDKLNELDRRILKESFRQVRKLQSRIKMDYQV