Protein Info for Dsui_1992 in Dechlorosoma suillum PS

Annotation: ribosomal protein L9

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 PF01281: Ribosomal_L9_N" amino acids 1 to 47 (47 residues), 80.2 bits, see alignment E=6.4e-27 TIGR00158: ribosomal protein bL9" amino acids 1 to 146 (146 residues), 150.1 bits, see alignment E=3.3e-48 PF03948: Ribosomal_L9_C" amino acids 63 to 145 (83 residues), 88 bits, see alignment E=4.5e-29

Best Hits

Swiss-Prot: 72% identical to RL9_CUPNH: 50S ribosomal protein L9 (rplI) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K02939, large subunit ribosomal protein L9 (inferred from 72% identity to reh:H16_A2276)

MetaCyc: 50% identical to 50S ribosomal subunit protein L9 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L9p" in subsystem CBSS-262719.3.peg.410 or Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QI10 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Dsui_1992 ribosomal protein L9 (Dechlorosoma suillum PS)
MQIILLEKVVNLGNLGDVVKVKDGYARNYLIPQRKAKRATPAALAEFEVKRAELEKAQAD
KLAAAEAQAGQLNGLMVQISRKAGMDGRLFGSVSNFDIAEALEAQGQKVEKAAIRMPNGH
LKAIGDYPIDIALHTDVIAQITVSVLGEH