Protein Info for Dsui_1978 in Dechlorosoma suillum PS

Annotation: putative lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF06804: Lipoprotein_18" amino acids 29 to 370 (342 residues), 153.7 bits, see alignment E=2.9e-49

Best Hits

Swiss-Prot: 68% identical to BAMC_ACCPU: Outer membrane protein assembly factor BamC (bamC) from Accumulibacter phosphatis (strain UW-1)

KEGG orthology group: K07287, lipoprotein-34 (inferred from 68% identity to app:CAP2UW1_1373)

Predicted SEED Role

"Outer membrane protein NlpB, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and YfgL); Lipoprotein-34 precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHZ6 at UniProt or InterPro

Protein Sequence (377 amino acids)

>Dsui_1978 putative lipoprotein (Dechlorosoma suillum PS)
MKRIVCTPLVASLLLAGCSGILPESKKIDYKSAIKAPTLEIPPDLTSPTRDDRYAVPDTG
GRGSATFSAYAAERDPQARGSAKSSEVLPQVDKTRIERSGTQRWLVVAGTPDQVWPMIKD
FWQETGFLVNVEVPEAGVMETDWAENRAKIGEDIIRSTLGKMFDSLYSTAERDKFRTRIE
PGAEPGTVDIFISHRGMYEVYISEGKDQTRWQPREADPELEAEMLRRLMVRFGTEEKKAE
AMVAAAKDRQVERAKLTRADDGQGALELQERFDRAWRRVGLSLDRVGFTVEDRDRSKGLF
FVRYVDPEVDDKKADKSFMSKLAFWKGDDKSDSKIQYRILVKDQGSSCTVQVLSREGGVD
RSDTAKKILGLLYEQLK