Protein Info for Dsui_1975 in Dechlorosoma suillum PS

Annotation: MoxR-like ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 PF07726: AAA_3" amino acids 44 to 174 (131 residues), 208.7 bits, see alignment E=6.3e-66 PF07728: AAA_5" amino acids 50 to 172 (123 residues), 46.2 bits, see alignment E=1.2e-15 PF00004: AAA" amino acids 51 to 155 (105 residues), 28.4 bits, see alignment E=5.1e-10 PF17863: AAA_lid_2" amino acids 237 to 296 (60 residues), 57.5 bits, see alignment E=2.4e-19

Best Hits

Swiss-Prot: 47% identical to YEAC_BACSU: Uncharacterized protein YeaC (yeaC) from Bacillus subtilis (strain 168)

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 74% identity to dar:Daro_2517)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHZ3 at UniProt or InterPro

Protein Sequence (313 amino acids)

>Dsui_1975 MoxR-like ATPase (Dechlorosoma suillum PS)
MPLPASQTSPGDGITAVLDAANRVILGKDTQVRLALACLLARGHLLIEDLPGVGKTTLAH
TLARLLGLDFQRIQFTSDMLPADILGVSIFDREHADFRFLPGPIFTQVVLADEINRATPK
TQSALLEAMEEHQVTAEGITRPLPEPFFVIATQNPAHQVGTFPLPESQLDRFLLRLELGY
PDSRAERALLESGGRRSQVAALAPCLTPPALAGLQDEVARVHAAPPLLDYVQALVEASRR
APAFRHGLSPRAALALLAVSRAWAYLAGRRQVLPEDVQAVWPALACHRLPLAQGSGHASP
EEALALLRGVALP