Protein Info for Dsui_1969 in Dechlorosoma suillum PS

Annotation: protein-L-isoaspartate and D-aspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 14 to 223 (210 residues), 198.3 bits, see alignment E=7e-63 PF01135: PCMT" amino acids 17 to 222 (206 residues), 190 bits, see alignment E=2.4e-60

Best Hits

Swiss-Prot: 75% identical to PIMT_DECAR: Protein-L-isoaspartate O-methyltransferase (pcm) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 74% identity to app:CAP2UW1_1364)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHY7 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Dsui_1969 protein-L-isoaspartate and D-aspartate O-methyltransferase (Dechlorosoma suillum PS)
MATGVSGIGMTSLRTRMRMVERLRDKGIVDETVLAAMAAVPRHIFVEEAMAHRAYEDTAL
PLGHSQTISQPYIVARMIELLRAGREQSLPGGLGKTLEIGAGCGYQAAVLAQLAPDVYAV
ERIEPLIERAKQNLRQMQQFNVRLKYADGQLGLPEAAPYHTIIVAAAANRVPPALLQQLA
VGGRMVLPVGAGEQALHLIERTPQGFLETKLDAVRFVPLLSGVE