Protein Info for Dsui_1955 in Dechlorosoma suillum PS

Annotation: 3'-5' exonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF10108: DNA_pol_B_exo2" amino acids 47 to 260 (214 residues), 309.1 bits, see alignment E=1.6e-96 PF13482: RNase_H_2" amino acids 55 to 219 (165 residues), 40.4 bits, see alignment E=3e-14

Best Hits

KEGG orthology group: K07501, hypothetical protein (inferred from 81% identity to app:CAP2UW1_2892)

Predicted SEED Role

"Polysaccharide biosynthesis protein WlaX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHX5 at UniProt or InterPro

Protein Sequence (265 amino acids)

>Dsui_1955 3'-5' exonuclease (Dechlorosoma suillum PS)
MVPVLVFDIETIPDVPGLRRLHDLPADLSDDEVAELAFQQRRAQNGSDFLPLHLQRVVTI
SCALRARDAFKVWSLAAPEIGEGEIIQRFFDGIEKFTPQIVSWNGGGFDLPVLHYRGLIH
GVVAPRYWDLGDGDYADSRDFKWNNYISRYHTRHLDLMDLLAMYQPRASAPLDDLAKLMG
FPGKLGMDGGKVWQAWQEGKADEIRDYCETDVVNTYLVSTRFRLMRGEVSREEHLAELAF
IKAELAKLDKPHWQEFLAAWPEVAA