Protein Info for Dsui_1948 in Dechlorosoma suillum PS

Annotation: dTDP-glucose 4,6-dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF04321: RmlD_sub_bind" amino acids 2 to 175 (174 residues), 38.9 bits, see alignment E=1.7e-13 PF02719: Polysacc_synt_2" amino acids 2 to 111 (110 residues), 34.9 bits, see alignment E=3e-12 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 2 to 337 (336 residues), 510.5 bits, see alignment E=8.4e-158 PF01370: Epimerase" amino acids 2 to 250 (249 residues), 234 bits, see alignment E=5.3e-73 PF01073: 3Beta_HSD" amino acids 3 to 229 (227 residues), 36.8 bits, see alignment E=7.2e-13 PF16363: GDP_Man_Dehyd" amino acids 3 to 323 (321 residues), 325.7 bits, see alignment E=1.3e-100 PF07993: NAD_binding_4" amino acids 4 to 186 (183 residues), 33.3 bits, see alignment E=8.6e-12

Best Hits

Swiss-Prot: 68% identical to RMLB_XANCB: dTDP-glucose 4,6-dehydratase (rfbB) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 82% identity to del:DelCs14_5242)

MetaCyc: 60% identical to dTDP-glucose 4,6-dehydratase 1 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.46

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHW8 at UniProt or InterPro

Protein Sequence (353 amino acids)

>Dsui_1948 dTDP-glucose 4,6-dehydratase (Dechlorosoma suillum PS)
MILVTGGAGFIGSNFVIDWLAAGDEPVINLDKLTYAGNLENLQGLAGDPRHRFVRGDIAD
YDLILELLQQNRVRAVVNFAAESHVDRSIHGPEDFIQTNIVGTFRLLEAVRAYWNGLPAD
DKAAFRFLHVSTDEVYGSLEKEAPAFTEQHRYEPNSPYSASKAASDHLVRAYHHTYGLPV
LTTNCSNNYGPYHFPEKLIPLIIHNALAGKPLPIYGDGQQIRDWLYVKDHCSAIRRVLEA
GRLGETYNVGGWNEKPNLEVVHTLCAMLDELSPRADGASYASQITFVADRPGHDRRYAID
ASKLERELGWKPAETFETGIRKTVRWYLDNPQWVHNVTSGAYREWVGRQYGEA