Protein Info for Dsui_1946 in Dechlorosoma suillum PS

Annotation: putative N-acetylglucosaminyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13432: TPR_16" amino acids 44 to 91 (48 residues), 26.1 bits, see alignment 5.1e-09 amino acids 191 to 236 (46 residues), 22.1 bits, see alignment 9e-08 PF13176: TPR_7" amino acids 74 to 100 (27 residues), 22.6 bits, see alignment (E = 3.9e-08) PF18073: Rubredoxin_2" amino acids 352 to 376 (25 residues), 34.4 bits, see alignment (E = 7.1e-12)

Best Hits

KEGG orthology group: None (inferred from 74% identity to app:CAP2UW1_2896)

Predicted SEED Role

"Heat shock (predicted periplasmic) protein YciM, precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHW6 at UniProt or InterPro

Protein Sequence (389 amino acids)

>Dsui_1946 putative N-acetylglucosaminyl transferase (Dechlorosoma suillum PS)
MIEFEYWQLLLFPLFFVLGWAAARIDIKHLVRESRALPRSYFQGLNFLLNEQPDKAIEAF
IEVVKVDPQTVELHFALGNLFRRRGETERAIRMHQNLIERVDLSPELKLQALSELGQDFL
KAGLLDRAEEVFSRLRGTSRDEEAKRNLLEIYQQEKDWQKAIAIAKEMPDYATQKEIANY
YCELAAGEMINSRPDSARQYLDSALSLHRNCVRASVLQGDLLQQGGDLAAAIEAWKRIES
QNPAYLAIVARKLQDAYLAQGQREEGLQLLRGYLASYPSLDLLETVFQLVMDAEGPEAAY
RLVRDELRRNPTLLGLDRLLEAQLLGVPPEKRADLELVRNLVHNHTRRLARYRCDNCGFK
ARHFYWRCPACGGWETYPPRRTEEFDLIP