Protein Info for Dsui_1941 in Dechlorosoma suillum PS

Annotation: prephenate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF03807: F420_oxidored" amino acids 6 to 94 (89 residues), 31.1 bits, see alignment E=4.5e-11 PF02153: PDH_N" amino acids 19 to 174 (156 residues), 113.3 bits, see alignment E=1.2e-36 PF20463: PDH_C" amino acids 177 to 276 (100 residues), 97.9 bits, see alignment E=5.7e-32

Best Hits

KEGG orthology group: K04517, prephenate dehydrogenase [EC: 1.3.1.12] (inferred from 78% identity to dar:Daro_1234)

Predicted SEED Role

"Cyclohexadienyl dehydrogenase (EC 1.3.1.12)(EC 1.3.1.43)" in subsystem Chorismate Synthesis or Phenylalanine and Tyrosine Branches from Chorismate (EC 1.3.1.12, EC 1.3.1.43)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.12 or 1.3.1.43

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHW1 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Dsui_1941 prephenate dehydrogenase (Dechlorosoma suillum PS)
MAEFNKVVIFGVGLIGGSFALGLRAAGAVEEVVGFGRSPKSLQQALDLGVIDRAGINPAH
ELSDADLVLLATPVGQMPEIMARIVPYLGPETVVTDGGSTKGDVVAAARAAFGERIGQFV
PAHPIAGAENSGAAAARADLYRERKVVLTPLPENSVLNVAKVRSAWEWCGAQIYELTPAE
HDRVFAAVSHLPHLLSFALVHDLAVRENKELFFTFAASGFRDFTRIAASHPEMWRDICLA
NKDALLLELDSYRAQLDELHQALAAGDGRRLEEIFDTARTARRDWAEGKR