Protein Info for Dsui_1932 in Dechlorosoma suillum PS

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF13404: HTH_AsnC-type" amino acids 7 to 50 (44 residues), 30.1 bits, see alignment E=5.4e-11 PF22451: NirdL-like_HTH" amino acids 11 to 57 (47 residues), 55.7 bits, see alignment E=4.4e-19 PF17805: AsnC_trans_reg2" amino acids 68 to 159 (92 residues), 84 bits, see alignment E=9.8e-28

Best Hits

Swiss-Prot: 49% identical to NIRH_PSEST: Protein NirH (nirH) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 73% identity to tmz:Tmz1t_2610)

MetaCyc: 58% identical to siroheme decarboxylase NirH subunit (Paracoccus pantotrophus)
RXN-15805 [EC: 4.1.1.111]

Predicted SEED Role

"Heme d1 biosynthesis protein NirH" in subsystem Dissimilatory nitrite reductase or Heme biosynthesis orphans

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.111

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHV2 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Dsui_1932 transcriptional regulator (Dechlorosoma suillum PS)
MDATFPMDDLDRRIVLATQAGLPLVPRPYLVLAEQLGVAETEIRQRLARLLAAGAIRRIG
AVPNHYAIGYTANGMSVWQIDPAVIDAVGKRVGGLQSVTHCYRRPDHPPAWPYNLFAMVH
GKSRAEVEAEVGRIATLIQAEFPGALGARDILFSTRILKKTGLRLGE