Protein Info for Dsui_1928 in Dechlorosoma suillum PS

Annotation: cytochrome c, mono- and diheme variants family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF13442: Cytochrome_CBB3" amino acids 38 to 108 (71 residues), 42.5 bits, see alignment E=3.3e-15

Best Hits

Swiss-Prot: 45% identical to NIRC_PSEST: Cytochrome c55X (nirC) from Pseudomonas stutzeri

KEGG orthology group: None (inferred from 58% identity to app:CAP2UW1_2487)

Predicted SEED Role

"Cytochrome c55X precursor NirC" in subsystem Dissimilatory nitrite reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHU8 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Dsui_1928 cytochrome c, mono- and diheme variants family (Dechlorosoma suillum PS)
MKPAISFPCICLSGLGLTAALLPLAVSATEVAVPAPRAQELVHMVRQDCGSCHGLTLKGG
LGPALTAETFRQRPAESMVATILHGRPGTPMPPFKGIINEAEAQWIVQQLQAGFPNE