Protein Info for Dsui_1916 in Dechlorosoma suillum PS

Annotation: cytochrome d oxidase cyd, subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00203: cytochrome d ubiquinol oxidase, subunit II
  • amino acids 2 to 379 (378 residues), 502.5 bits, E=4.3e-155
• PF02322: Cyt_bd_oxida_II
  • amino acids 8 to 362 (355 residues), 352.6 bits, E=1e-109

Best Hits

Swiss-Prot: 59% identical to CYDB_ECOL6: Cytochrome bd-I ubiquinol oxidase subunit 2 (cydB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 66% identity to azo:azo1231)

MetaCyc: 59% identical to cytochrome bd-I subunit 2 (Escherichia coli K-12 substr. MG1655)
RXN0-5266 [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]; 1.11.1.- [EC: 7.1.1.7]

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• succinate to cytochrome bd oxidase electron transfer (2/2 steps found)
• NADH to cytochrome bd oxidase electron transfer II (1/2 steps found)
• pyruvate to cytochrome bd oxidase electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 7.1.1.7

Sequence Analysis Tools

See G8QHE5 at UniProt or InterPro

Protein Sequence (379 amino acids)

>Dsui_1916 cytochrome d oxidase cyd, subunit II (Dechlorosoma suillum PS)
MLFDYLTLKLIWWLLVGVLLIGFAIMDGHDMGVGILLPILGRDDTDRRVMINTVAPHWDG
NQVWFITAGGAIFAAWPFVYATAFSGMYWALLLVLFALFFRPVGFEYRSKLPHPAWRSAW
DWGLFAGSAVPALVFGVAFGNLFQGVPFHLDETMRSFYTGSFWALLNPFALLCGVVSLSL
LALQGATFLAHRTEGELQARARGAGTVLAVLLLAAFSAAGVWVGRLDGFVIQSIADVGGA
LNPLMKEVVRQPGAWFANYQKYPLLWAVPALAYAGGLLALACLRAGKILVAFVGSSVACL
AVILTAGVALFPFVLPSSTLPKASLTAWDATSSYVTLNVMLYVALIFTPIVIAYTGWAYR
VMAGKVTRDYIVANDKALY