Protein Info for Dsui_1913 in Dechlorosoma suillum PS

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 91 to 119 (29 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details PF02518: HATPase_c" amino acids 318 to 418 (101 residues), 62.7 bits, see alignment E=2.1e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHE2 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Dsui_1913 signal transduction histidine kinase (Dechlorosoma suillum PS)
MPSPAPFPPPRPLRRLRLDADLLIALRWGSVLAMAAITLGFPRLLGITIAPLPLLATATF
LALVNGAAMLLRHWDREPIPAMTQLMVDLLSWSIVIYFSGGATNPLISLLLPVVAIGAAM
LPTLQAWLLGAFSILTYSFLWNFYQPLEVKDATIAVQLHLLGMWLTFLASVLISVWFITR
MTAAIRIRDQALARARENEIRNGWVVSLGTLAAGAAHELSTPLATMKLVVDDLVEDAELP
PRTRQELAGLKLQIDKCKSALTRLTAEAGRPRAEERRQRRVQDWLEECAHGWRALHPAAS
IALRIDAEAAGRLVAADVALEQALHNLVDNGVRFSPEWLEVSATVHGPWLHLVIADQGPG
IPEDVLAAAGQPLPVHSDSGLGIGLLLARSAIQRCGGQLHLAPRQPRGTDVTLKLPLKDC