Protein Info for Dsui_1905 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 839 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 265 to 285 (21 residues), see Phobius details PF00497: SBP_bac_3" amino acids 37 to 252 (216 residues), 80.2 bits, see alignment E=4.8e-26 TIGR00229: PAS domain S-box protein" amino acids 301 to 425 (125 residues), 63.6 bits, see alignment E=9.6e-22 PF00989: PAS" amino acids 305 to 416 (112 residues), 53 bits, see alignment E=1.4e-17 PF13188: PAS_8" amino acids 306 to 353 (48 residues), 26 bits, see alignment 2.7e-09 PF08448: PAS_4" amino acids 311 to 421 (111 residues), 77.9 bits, see alignment E=2.7e-25 PF13426: PAS_9" amino acids 314 to 418 (105 residues), 37.3 bits, see alignment E=1.2e-12 PF00512: HisKA" amino acids 457 to 522 (66 residues), 77.1 bits, see alignment 3.6e-25 PF02518: HATPase_c" amino acids 568 to 682 (115 residues), 86.8 bits, see alignment E=5.8e-28 PF00072: Response_reg" amino acids 714 to 827 (114 residues), 92 bits, see alignment E=1.1e-29

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHD5 at UniProt or InterPro

Protein Sequence (839 amino acids)

>Dsui_1905 PAS domain S-box (Dechlorosoma suillum PS)
MTQFPAVPAITRLLGTLLLACCAALSAGPAGADEPPLRVTSDDNYPPYIFRDPSGQPVGY
LVDLWSLWEQKTGRRVQLIATDWGRAQRLMAENEADVIDMIFHTAARDALYEFSQPYANL
PVGIYSHSSISGISNTDNLKGFLIGVQVGDACIEELQGKGVTNLRQFKNYAEMIAAAMAE
EIKLFCLDQLPANYYLYRLDLQRQFRKSFDLYQGRFHRATRKGDTATLAAVERGMALISN
EERAALEKKWMGSAIDYVPYMPYARYFGLGLALLLVAGAGLALWVRVLQAAVKRRTAELE
RQRSHLHTLLRGIPDPLWLKDEAGVFIACNPAFERMMGRPEQEIIGCSDYDFVSREQADF
FRDKDRQVLVAGTPQSNEEWITQADGSGQRLFETVKTPIVEPQGKVLGVLGVARDITERK
RLEAEVSNYSHHLEELVAERTEELARARDAANAANVAKSAFLANMSHEIRTPMNAIIGLT
HILKKGEPSPQQQDRLDKIDDAASHLLSIINDILDLSKIEAERLVLEEQPVELGRIVSHI
FSMLAEGARKKDIVLKSEVDPLPPYLLGDPTRLTQAILNYASNAVKFTEWGSVTLRIKVL
ELTPADVFLRFEVEDTGIGIAPEVQPLLFAPFQQADGSTSRRFGGTGLGLVITRRLAQIM
GGDAGVDSRLGFGSTFWFSARLKLGEARAALPEDGPRPDSAEGELLQHYRGTPILLAEDD
SINQEVARELLEYAGLRVDIAADGNEAVACLERGTTPYALVLMDMQMPGMDGLEATRHIR
RLPGMESLPIISMTANAFGEDRERCLEAGMNDFVPKPVNPEVLYAMLLKWLPRPQTPNA