Protein Info for Dsui_1896 in Dechlorosoma suillum PS

Annotation: arabinose efflux permease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 signal peptide" amino acids 20 to 20 (1 residues), see Phobius details transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 180 to 200 (21 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 368 (335 residues), 115.9 bits, see alignment E=1e-37

Best Hits

KEGG orthology group: None (inferred from 76% identity to dar:Daro_0839)

Predicted SEED Role

"Major facilitator superfamily precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHC6 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Dsui_1896 arabinose efflux permease family protein (Dechlorosoma suillum PS)
MADPMLQRTNNMSPSSPSAWRTPTLILVCGCIILTLSMGIRHTGGLFLQPMTGALGWNRE
VFSFAFAIQNLVWGLGSPFAGAFADRYGAGRVIAASALLYVVGLALMAVSSTGLALDLSA
GVLVGLGLSGTTFAVIMGVIGRHTTPEKRSLALGIASAGGSFGQFAVLPIGQALISSFGW
QAALFLLACGVGLIAPLAYAMADGHKHVSGAGQSAGAALVEAGGQRSFHYLFWSYFVCGF
QTAFIMLHLPSFAVDSGFSANVGMTGIALIGLFNIFGSFLFGWAGGKGSKKNLLMLIYGA
RVVVIGAFMLAPLSVASIWIFSACMGLLWLATVPLTNGLIAQVFGLRFMSMLAGIVFLGH
QLGSFLGAWLGGMIFDKTGSYDLAWLLSIGLSVIAAILCWPIDERPVQRAEPKPAGA