Protein Info for Dsui_1893 in Dechlorosoma suillum PS

Annotation: putative membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 51 to 72 (22 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details PF06993: DUF1304" amino acids 14 to 117 (104 residues), 147.3 bits, see alignment E=8.2e-48

Best Hits

KEGG orthology group: K08987, putative membrane protein (inferred from 69% identity to gau:GAU_2196)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHC3 at UniProt or InterPro

Protein Sequence (123 amino acids)

>Dsui_1893 putative membrane protein (Dechlorosoma suillum PS)
MTVLSTAAAIATLLVALLHAYILVLEMFCWNTPKGRKAFGLTPEFAAATRVLAANQGLYN
GFLAAGLLWGLLPGEAGFSIRCFFLGCVVVAGIFGAATASRRILFVQALPGALALGLNLL
AAL