Protein Info for Dsui_1887 in Dechlorosoma suillum PS

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 736 PF13188: PAS_8" amino acids 24 to 67 (44 residues), 16.1 bits, see alignment 2.6e-06 amino acids 142 to 199 (58 residues), 26.5 bits, see alignment 1.3e-09 amino acids 267 to 320 (54 residues), 16.6 bits, see alignment 1.8e-06 PF00989: PAS" amino acids 29 to 127 (99 residues), 48.5 bits, see alignment E=2.4e-16 amino acids 143 to 242 (100 residues), 42.9 bits, see alignment E=1.4e-14 amino acids 267 to 309 (43 residues), 24.3 bits, see alignment 7.8e-09 TIGR00229: PAS domain S-box protein" amino acids 30 to 137 (108 residues), 58 bits, see alignment E=5.2e-20 amino acids 138 to 260 (123 residues), 90.3 bits, see alignment E=5.3e-30 PF08448: PAS_4" amino acids 31 to 129 (99 residues), 31.2 bits, see alignment E=6.7e-11 amino acids 161 to 256 (96 residues), 27.8 bits, see alignment E=7.4e-10 amino acids 363 to 400 (38 residues), 28.4 bits, see alignment 5e-10 PF13426: PAS_9" amino acids 32 to 128 (97 residues), 58.5 bits, see alignment E=2.1e-19 amino acids 155 to 253 (99 residues), 40.3 bits, see alignment E=1e-13 amino acids 277 to 397 (121 residues), 25.6 bits, see alignment E=3.8e-09 PF08447: PAS_3" amino acids 38 to 122 (85 residues), 41.6 bits, see alignment E=3.8e-14 amino acids 164 to 236 (73 residues), 35.5 bits, see alignment E=3e-12 PF02518: HATPase_c" amino acids 619 to 728 (110 residues), 94.7 bits, see alignment E=1.5e-30

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHB7 at UniProt or InterPro

Protein Sequence (736 amino acids)

>Dsui_1887 PAS domain S-box (Dechlorosoma suillum PS)
MPSLPDPGPIPPGLPELLHGEVLLRHLQVSVADDQGAILYVNERMCEACGYRPDELLQHN
YSVLATGRHPPEFFAELWQTVRAGFEWRGEMSNRRKDGSEYWIELTVVPLPAEGNLPRRY
VGLGSDITRIVEAEQQLRSSEARFRGLTETISAAVILYKGGPMLYVNRAMERLTGYSRAE
LLQMSFFDLAHPSVRDLLQERAAARLRGEAMPATYEAPFVTKAGKTIWMEITAARIEYEG
GYAGLGTAIDITERKRAEAAQRSTQQMLQQIIDGDPVPTFVIDAEHRVTHWNAACALVTG
MPGEKIIGSTRAWSGFYAEERPVLAELVVDGTADSRITGLYGDTFRRSPIIPGAYEVESF
FPNFGDRGRWLFFTAAPLKDAQGRIIGAIETLVDVTERKEAEEALRNAHTKLEILVERRT
AQLSLAKQALEEDVRRREASENELRQRNAELLEVNKRLQEAQEQLVQSEKMASIGQLAAG
VAHEINNPIGYVQSNLSTLGRYLEDMQTVLDSLATAVAQLPSEHPAAQAVARVKQDLDFD
FLLEDLPSLVTQSRDGIDRVRKIVADLKDFSRLDASQDWQWADLHQGLDSTLNIVNNEIK
YRAEVVREYGQLPEVECLPSQLNQVFLNLLVNSAHAMPEGQMGRITLRSGHDEPAHQVWL
EVEDNGSGISPENMHRLFDPFFTTKPVGKGTGLGLSLSYGIVQKHHGQITVSSELGKGTT
FRIVLPVSQPKEGATP