Protein Info for Dsui_1878 in Dechlorosoma suillum PS

Annotation: DMT(drug/metabolite transporter) superfamily permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 179 to 200 (22 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 242 to 261 (20 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details PF00892: EamA" amino acids 10 to 139 (130 residues), 72.1 bits, see alignment E=2.6e-24 amino acids 151 to 285 (135 residues), 73.1 bits, see alignment E=1.3e-24

Best Hits

Swiss-Prot: 41% identical to YIJE_ECOLI: Probable cystine transporter YijE (yijE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to dar:Daro_1098)

MetaCyc: 41% identical to cystine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-267

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHA9 at UniProt or InterPro

Protein Sequence (309 amino acids)

>Dsui_1878 DMT(drug/metabolite transporter) superfamily permease (Dechlorosoma suillum PS)
MNAYRRWLPLLALVVLSLTWGYTWVLAKQGLAHAAPFAFAAERCIGAALALVVVLRLLGK
PLRLVAPGQTLAIGLTQVAGFMVFQTWALVEGGPGKTAVLIFTMPIWTLLLAWPILGERV
RGKQWLAAGSTLVGLLLIIAPWDMHSSLFSKFLGLMAALCWAVGTILIKRLRGAQPVDLL
VLTTWQMIIGAVPLTLLALVVPEHPTDWNLSYVGILMFMSVASTALCWWLWIYILDRVPA
WEASLSVLGTPVVAILSSRLTFGEAFQASEVAGILLIGGGLALLSFFGWLASKRNPIVVP
AAGPEGKNP