Protein Info for Dsui_1871 in Dechlorosoma suillum PS

Annotation: hydrophobe/amphiphile efflux-1 (HAE1) family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1044 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 341 to 360 (20 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details amino acids 439 to 465 (27 residues), see Phobius details amino acids 472 to 498 (27 residues), see Phobius details amino acids 534 to 553 (20 residues), see Phobius details amino acids 864 to 882 (19 residues), see Phobius details amino acids 889 to 911 (23 residues), see Phobius details amino acids 917 to 941 (25 residues), see Phobius details amino acids 963 to 984 (22 residues), see Phobius details amino acids 997 to 1020 (24 residues), see Phobius details TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1022 (1022 residues), 1250.1 bits, see alignment E=0 PF00873: ACR_tran" amino acids 1 to 1019 (1019 residues), 1138.4 bits, see alignment E=0 PF02355: SecD_SecF_C" amino acids 338 to 481 (144 residues), 21.3 bits, see alignment E=2.4e-08 PF03176: MMPL" amino acids 340 to 497 (158 residues), 34.7 bits, see alignment E=1.5e-12

Best Hits

Swiss-Prot: 56% identical to BEPE_BRUSU: Efflux pump membrane transporter BepE (bepE) from Brucella suis biovar 1 (strain 1330)

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 72% identity to dar:Daro_2161)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHA2 at UniProt or InterPro

Protein Sequence (1044 amino acids)

>Dsui_1871 hydrophobe/amphiphile efflux-1 (HAE1) family transporter (Dechlorosoma suillum PS)
MSRFFINRPIFASVISIVIVIAGIMASRVLPISQYPEIAPPTVIISASYPGASAETLAKT
VAAPIEEQLSGVENLMYFNSTASANGSLSITATFEVGTDVDMATVNVNNRVKIAEPRLPD
VVRQYGVTVQKRSNDILMVAAITSPEGTRTPLYLSNYALVNILDDLKRIPGVGDAQIFGA
LDYSMRLWLRPDRMAQLGVTTTEISNAIAAQNKQNAAGKIGQEPAPNGQQLVYTVTAKGR
LTTPEQFGNIVIRADGPKGALYLKDVARVELGAQNYDASTALMGKPVVGVGIFLQSGANA
LDVAKKVKLRMDELKQKFPSDVDYVVPFDTTKFVQASITEVVHTLVEALVLVAIVVFVFL
QNWRATVIPLVAVPVSLIGTFAGLWLFGFSINTLTLFAMVLAIGIVVDDAIVVLENVERL
MWEEKMAPKEAAIEAMREVSSAVVAIVLVLCAVFIPVAFLGGIAGMLYKQFAVTVAISVT
LSGIVALTLTPALCALLLQPKHEEPAIFRPFNRLFERFTKSYTDTVNKTLHHRIIGTVAC
VVILGGSFFMFRAVPGGFVPAEDQGYLISALMLPDGASLQRTRATGDQFQSMIKQDEAVD
RVFVIAGNDIIGGGMKPNAGTVFIPLKDWDERKAGADDLAKKFMGMGMMLPDGLGLVFNP
PAIRGLGNAGGFEAYIQARGDADPQKLSGVVQQFMEGLKKRQELVGINTFFRPTSPQLSV
EVNEAKAISMGIAVSDVYQTLQATMGTLYVNDFNLNGRTYRVQLQADGQFRSKPEDLGRV
YVKSSSGSMVPVSALIKVKSVVGPEQLERFNGFLSAKVMGSSVPKVSTGDAIKIVEEVAK
ETLPAGYELEWTGQAFQEKRTGTTSAVAFGFGIIMVFLILAAQYEKWSLPLAVILAVPFA
LFGALAAVMIRGMPNDIYFQIGLVVLIGLAAKNAILIVEFAAQKRAEGLGVLEAALEGAR
LRFRPIVMTSLAFILGVFPLVKATGAGAAARKSMGTGVFGGMLAATFIATIFIPMFFTWL
SGRRANLPEGSYHHVAHDNKEEGQ