Protein Info for Dsui_1870 in Dechlorosoma suillum PS

Annotation: efflux transporter, outer membrane factor lipoprotein, NodT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 20 to 473 (454 residues), 396 bits, see alignment E=1.2e-122 PF02321: OEP" amino acids 75 to 264 (190 residues), 114.9 bits, see alignment E=1.9e-37 amino acids 288 to 472 (185 residues), 138.2 bits, see alignment E=1.4e-44

Best Hits

KEGG orthology group: None (inferred from 53% identity to mei:Msip34_1695)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein CmeC" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QHA1 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Dsui_1870 efflux transporter, outer membrane factor lipoprotein, NodT family (Dechlorosoma suillum PS)
MSRPASHAPFALSQGLVATLTLLALAGCAVGPDYKRPEATLPEAYVATAEAAPAAQAPVE
KEWWKLFQDATLNDLVRQAQEHNHDLLLAVAQVEEAEGVAREAGAAFFPQIDANASGGRN
EISMKTDPLPAANTQRLRDSRKASLSTSFEIDVWGKLRRANEAARAQLLSSRYARDTVEL
SVASLVTNAYLTLRAADADLALTRDTVATREKALDIVKSKQEAGSASPLDLHQAESTLAT
AQAQAASLRRQRAVAETQLALLTGKPDLKIAAGDLRQLPLPPVPPAGLPSSLLEARPDIR
QAEETLVAANAKIGVAKAALYPSLSLTGSLGSESAALTNLFTSAAGAWSLGLAATMPIFD
FGRNAARIDQATAKQKQALISYQKTVQTAFKEVNDALVGLRENGEGERAQEKRVQATQKT
LELAQLRYEAGYSAFLEVLDAQRSANDALLDYVSTRQARLTSAVDLFKALGGGWKDDFKA
ESLKNSGNDQAAAPVAKAGQ