Protein Info for Dsui_1863 in Dechlorosoma suillum PS

Annotation: response regulator containing a CheY-like receiver domain and an HD-GYP domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00072: Response_reg" amino acids 6 to 118 (113 residues), 81 bits, see alignment E=1.1e-26 PF13487: HD_5" amino acids 161 to 324 (164 residues), 120.9 bits, see alignment E=7.7e-39 PF01966: HD" amino acids 171 to 293 (123 residues), 77.9 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 46% identical to RPFG_XANC8: Cyclic di-GMP phosphodiesterase response regulator RpfG (rpfG) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K07814, putative two-component system response regulator (inferred from 61% identity to gca:Galf_2288)

Predicted SEED Role

"Response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH94 at UniProt or InterPro

Protein Sequence (346 amino acids)

>Dsui_1863 response regulator containing a CheY-like receiver domain and an HD-GYP domain (Dechlorosoma suillum PS)
MELNLVVIDDSEINLTLFRVLAERIEGVRVHGFLSSSEALAWCEQGQADVVVVDYMMPAP
DGLEFISHFRQLPGMAEVPLIMVTANNLRDVRCRALEQGASDFLNKPVDKDEFLARVRNM
CALRRSQRQLADRAAWLAEEVAKATAGLLERERETIVCLAKAAEYRDPETGAHILRMAHY
SVLIGRQLGLAPAELEMLLEAAPMHDVGKVGTPDLILLKPGRLTPAEFMIMQQHAEQGYE
ILRQARSPVLAMAAVIARAHHEKWDGSGYPQGLKGEAIPLLGRIVAVADVFDALTSPRPY
KQAWPLAQAREYLEQNAGRHFDPRCVEAFLAAWDEVLAIRERFQDQ