Protein Info for Dsui_1857 in Dechlorosoma suillum PS

Annotation: putative permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 181 to 200 (20 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details PF00892: EamA" amino acids 8 to 138 (131 residues), 59.1 bits, see alignment E=2.7e-20 amino acids 151 to 283 (133 residues), 52.3 bits, see alignment E=3.4e-18

Best Hits

KEGG orthology group: None (inferred from 49% identity to cja:CJA_1084)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QH88 at UniProt or InterPro

Protein Sequence (299 amino acids)

>Dsui_1857 putative permease, DMT superfamily (Dechlorosoma suillum PS)
MDNQHLRRGYFYAALTVAVWSGFILVSRLGGKSPLTAWDVTALRFGTAALILLPVWLWRR
PRLNFSWRMVILAVTGGCGYGVLVYAGFKLTSAAHGAVLLPGMLPFLVALMAWLVLGERP
SPQRWLGLVGIAAGIACLATDSFGSSVGDWRGDLLILASSLSWAIYTVLVRRWQVAPWDA
TLGVGLVSAALYLPVYVLWLPHNLAAASLSTIALQAAYQGVLAVIVAMMFFMRAVAILGP
TKVGTLMALIPAVAGTAAAPLLGEPLSPWLMAGLVLVSLGAWVGSQTRFFVRRNAVCPT