Protein Info for Dsui_1848 in Dechlorosoma suillum PS

Annotation: arsenical-resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 52 to 73 (22 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 252 to 276 (25 residues), see Phobius details amino acids 288 to 312 (25 residues), see Phobius details amino acids 318 to 340 (23 residues), see Phobius details TIGR00832: arsenical-resistance protein" amino acids 12 to 340 (329 residues), 386.7 bits, see alignment E=5e-120 PF01758: SBF" amino acids 58 to 252 (195 residues), 106.2 bits, see alignment E=8.9e-35

Best Hits

KEGG orthology group: K03325, arsenite transporter, ACR3 family (inferred from 86% identity to bac:BamMC406_6328)

Predicted SEED Role

"Arsenical-resistance protein ACR3" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See G8QGT8 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Dsui_1848 arsenical-resistance protein (Dechlorosoma suillum PS)
MNQPCPAPRPAMNLFERYLTLWVGLCIVAGILLGQALPQFFQAVGRLEVARVNLPVGLLI
WVMIIPMLVKVDFSALGEVRQHVRGIGVTLLVNWLVKPFSMAFLGWLFIRQLFAPLLPAE
QIDSYIAGLILLAAAPCTAMVFVWSRLTNGDPLFTLSQVAVNDSIMVLAFAPLVAFLLGL
SAITVPWATLITSVVLYIVIPVLLAQAWRRSLLARGPAAFDAAMARIGPWSMAALLATLV
LLFAFQGEAILAQPLVIALLAVPILIQVLFNAALAYGLNRALGEKHNIACPSALIGASNF
FELAVAAAISLFGFASGAALATVVGVLIEVPVMLLVVRIANGSKDWYERRS